PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA27216
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB
Protein Properties Length: 242aa    MW: 27235.2 Da    PI: 6.7314
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA27216genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.96.1e-102469346
                               SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                                WT e+d+l+ +a  + + +   +W++Ia+ ++ g++  ++++++ +
  Tp57577_TGAC_v2_mRNA27216 24 QWTREDDKLFERALLMVPEDlpnRWEKIAEQVP-GKSVAEVRDHYED 69
                               6*****************99*************.***********76 PP

2Myb_DNA-binding46.77.5e-15129173347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT+eE+ l++ + + +G+g+W++I+r +  +Rt+ q+ s+ qky
  Tp57577_TGAC_v2_mRNA27216 129 PWTEEEHRLFLVGLTTYGKGDWRSISRNVVVTRTPTQVASHAQKY 173
                                8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.8652074IPR017884SANT domain
SMARTSM007171.2E-82173IPR001005SANT/Myb domain
SuperFamilySSF466892.07E-122376IPR009057Homeodomain-like
PfamPF002493.8E-92470IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-62469IPR009057Homeodomain-like
CDDcd001673.28E-82571No hitNo description
Gene3DG3DSA:1.10.10.604.0E-11119174IPR009057Homeodomain-like
PROSITE profilePS5129420.47122178IPR017930Myb domain
SuperFamilySSF466891.38E-16124178IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-17125177IPR006447Myb domain, plants
SMARTSM007171.6E-11126176IPR001005SANT/Myb domain
CDDcd001672.30E-9129174No hitNo description
PfamPF002495.1E-12129173IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MYQKTIPMAT ATAATTRWPT QPTQWTREDD KLFERALLMV PEDLPNRWEK IAEQVPGKSV  60
AEVRDHYEDL VHDVLEIELG RVEVPSYPDD LAAVSGGGGG GLSDWDSSNQ ISFGSKNRNS  120
DNERKKGTPW TEEEHRLFLV GLTTYGKGDW RSISRNVVVT RTPTQVASHA QKYFLRQSAV  180
KKERKRSSIH DITSVDTNKA PMPIDQNWVP PPGGQPQQNH HYPSNNLHDQ MGSFGYSNYG  240
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-131487273RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013470249.11e-135MYB-like transcription factor family protein
SwissprotQ8S9H71e-60DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLG7ZYT01e-135G7ZYT0_MEDTR; DnaJ homolog subfamily C member
STRINGGLYMA20G24600.11e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-72MYB family protein